PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10032117
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 282aa    MW: 32323.1 Da    PI: 6.6725
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10032117genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.94.6e-131461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l + +   G ++W+ +++  g+ R++k+c++rw +yl
      Lus10032117 14 RGPWTIEEDHKLMNFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding51.62.1e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+ E+ + ++++ +lG++ W++Ia++++ gRt++++k++w++
      Lus10032117  67 RGAFTEAEENQMIQLHCRLGNR-WSKIASHLP-GRTDNEIKNHWNT 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.5E-21564IPR009057Homeodomain-like
PROSITE profilePS5129413.517961IPR017930Myb domain
SuperFamilySSF466895.62E-2811108IPR009057Homeodomain-like
SMARTSM007176.3E-61363IPR001005SANT/Myb domain
PfamPF002496.4E-111461IPR001005SANT/Myb domain
CDDcd001671.01E-41661No hitNo description
PROSITE profilePS5129425.85662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2565117IPR009057Homeodomain-like
SMARTSM007174.9E-1466114IPR001005SANT/Myb domain
PfamPF002499.7E-1567110IPR001005SANT/Myb domain
CDDcd001673.39E-1069110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGRQPCCEKV GLKRGPWTIE EDHKLMNFIL NNGIHCWRMV PKLAGLLRCG KSCRLRWINY  60
LRPDLKRGAF TEAEENQMIQ LHCRLGNRWS KIASHLPGRT DNEIKNHWNT RIKRKLKLAG  120
VDPVTHQPIL DNTNTKGGDR DDQKKQKLEE ELELSTMTTK LDEITTINDD NDDPLRRDYQ  180
VFGGSSLEYF GGHNKSSNTS TTSQGSTISS SIEESNSNNN YNYHRGINHE PVVVSNTQFD  240
DYDTLKQWVD GVDSSMFSWD DGFMNGNLDD DFFLHGKWTL L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00510DAPTransfer from AT5G14340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010033365.17e-97PREDICTED: myb-related protein 315
TrEMBLA0A059AG381e-97A0A059AG38_EUCGR; Uncharacterized protein
STRINGVIT_14s0219g00050.t012e-90(Vitis vinifera)
STRINGPOPTR_0001s36220.12e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66253150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.12e-79myb domain protein 40